PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G15090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 328aa    MW: 36136.4 Da    PI: 10.375
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G15090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.6e-402197177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
           SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                  +Cq+egC+adls ak+yhrrhkvC+ h+ka++v++ g++qrfCqqCsrfh l efDe+krsCr+rL +hn+rrrk++
  OB02G15090.1 21 RCQAEGCKADLSAAKHYHRRHKVCDYHAKAAAVVAGGKQQRFCQQCSRFHVLAEFDEAKRSCRKRLTEHNRRRRKPT 97
                  6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.8E-341483IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.1541996IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.79E-382098IPR004333Transcription factor, SBP-box
PfamPF031101.1E-302295IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGMGVLGLGL AAAHHHHQPP RCQAEGCKAD LSAAKHYHRR HKVCDYHAKA AAVVAGGKQQ  60
RFCQQCSRFH VLAEFDEAKR SCRKRLTEHN RRRRKPTAGG AQSRDSPPPP PPSKKGTDAG  120
VASSYTSDHK GAVGGGIRRR CLSRLASRRP QLSHSVATYT GSRQRAELGV AAGAAEEAHQ  180
RLVVVLSGDV GVLRAICRNH SSILSTSFIP IPLRLWHGDT RTPRRCHAQK FLTDGAEDGG  240
LGTVLLMQHH HQQEQQRQRR RQRVQDADVD GDGDDHHLMT MSSLARHHQQ HRHSSGSNND  300
DNILSCSSAS DQHNSAGNNM HFFEVDFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-2822951184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17895KRSCRKRLTEHNRRRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0116141e-108AJ011614.1 Zea mays mRNA for SBP-domain protein 1.
GenBankEU9668911e-108EU966891.1 Zea mays clone 297975 SBP-domain protein 1 mRNA, complete cds.
GenBankKJ7280091e-108KJ728009.1 Zea mays clone pUT6144 SBP transcription factor (SBP10) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ0E3F83e-52SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLJ3LA420.0J3LA42_ORYBR; Uncharacterized protein
STRINGOB02G15090.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-34squamosa promoter binding protein-like 8